Human papillomavirus type 16 E7, his tag
SKU: 90784187155

Human papillomavirus type 16 E7, his tag

Sale price$90.00 Regular price$100.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 9 - Jul 14

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human papillomavirus type 16 E7, his tagProduct Specification Species Human papillomavirus type 16 Accession P03129 Amino Acid Sequence Protein sequence (P03129, Met1 Pro98, with C 10*His) MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKPGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight Predicted MW: 12. 7 kDa Observed MW: 16, 20 kDa Purity 90% by SDS PAGE Endotoxin <1EU g Tag His Tag, with C 10*His Physical Appearance Lyophilized

Product Specification


Species Human papillomavirus type 16
Accession P03129
Amino Acid Sequence

Protein sequence (P03129, Met1-Pro98, with C-10*His) MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKPGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Predicted MW: 12.7 kDa Observed MW: 16, 20 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Tag His Tag, with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Human papilloma viruses (HPVs) can be classified as either high-risk or low-risk according to their association with cancer. HPV16 and HPV18 are the most common of the high-risk group while HPV6 and HPV11 are among the low-risk types. Approximately 90% of cervical cancers contain HPV DNA of the high-risk types. Mutational analysis have shown that the E6 and E7 genes of the high-risk HPVs are necessary and sufficient for HPV transforming function. The specific interactions of the E6 and E7 proteins with p53 and pRB, respectively, correlate with HPV high and low risk classifications. The high-risk HPV E7 proteins bind to pRB with a higher affinity than do the low-risk HPV proteins, and only the high-risk HPV E6 proteins form detectable complexes with p53 in vitro.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 90784187155

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 73 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
Port Orchard, US
★★★★★ 5
I started seeing results after one and a half week!
A week and a half after starting this product, together with the serum, I started noticing a brighter and more even tone on my skin. And my sun spots started to fade. It worked for me... and really fast! To give you an idea of how uneven my skin was... when going out, my husband used to tell me to put on some face powder to even out the tone of my skin. Not anymore. I felt it was really gentle, and I have a very sensitive/rosacea prone skin. I combine both the night cream and the serum with my Vanicream skincare regime. I later added a niacinamide serum (I got that tip from Dr. Dray on Youtube) to boost the efficiency of the whole treatment. Be careful with the niacinamide though... some people cannot tolerate it. I think I could tolerate it because I already had my skin repaired with my Vanicream skincare regime. In conclusion, this product is worth every penny!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 15, 2026
J
Verified Purchase
Jess
Louisville, US
★★★★★ 5
Great product, it works!
This moisturizer has help me a lot with my sunspots, I see the difference big time. I’m in my 3 bottle I think, and I also use their serum and night cream along with the face soap. Love this line of products and I’m coming from using Lancôme for years (my fave brand in so many products). I’d definitely recommend. I don’t find the creams smelling weird or with a sense at all (like some other people have said) and I have a K9 nose.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2026
L
Verified Purchase
Lisa
Lexington, US
★★★★★ 5
Simple but effective
I do like Eucerin products and this night cream is predictably smooth. I haven't noticed any miraculous change in my dark spots but I'm more interested in just keeping my skin soft. A little goes A LONG way so this bottle will last quite a while.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 24, 2026
D
Verified Purchase
Dawn Marie Matri
Alexandria, US
★★★★★ 5
This is thebest smelling, best working sunscreen on the market
Size: 5 Ounce (Pack of 2)
Great price for a great product. It smells heavenly! One week in the Caribbean sun - one daily application in the AM - NO BURNS for entire trip.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 10, 2026
P
Verified Purchase
Pepe DI
Dallas, US
★★★★★ 5
Great for Kids, Smells Nice, and No Harsh Chemicals
Size: 5 Ounce (Pack of 2)
This sunscreen spray is easy to apply, not greasy, and doesn’t leave a sticky residue. The tropical fruit scent is light and pleasant, which makes it easier to convince kids to wear it. I also like that Alba Botanica avoids oxybenzone and other harsh chemicals. It holds up well for swimming and outdoor play. The 2-pack is convenient to keep one at home and one in the beach bag. It is a great deal!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 3, 2025

recommand products