SKU: 30678838631

CXCL1 Protein, Human

Sale price$145.80 Regular price$162.00
Save 10%

Pay in installments of $40.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 16 - Jul 21

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CXCL1 Protein, HumanProduct Specification Species Human Synonyms rHuGRO CXCL1, NAP 3, MGSA, Growth regulated alpha protein Accession P09341 Amino Acid Sequence Ala35 Asn107, with C terminal Human IgG Fc

Product Specification


Species Human
Synonyms rHuGRO-α/CXCL1, NAP-3, MGSA, Growth-regulated alpha protein
Accession P09341
Amino Acid Sequence

Ala35-Asn107, with C-terminal Human IgG Fc ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSNIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 35-40kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Pathol Res Pract . 2014 Feb;210(2):74-8. Epub 2013 Oct 28.

Background

CXCL1 (Chemokine (C-X-C motif) ligand 1), also known as GRO alpha, NAP-3 or MGSA, belongs to the sub-family of CXC chemokine. In general, CXCL1 levels are extremely low under normal physiological conditions and significantly elevated under inflammatory conditions. CXCL1 acts as a key chemoattractant for neutrophils by binding specifically to its corresponding G-protein-coupled receptor CXCR2. CXCL1 regulates angiogenesis, tumorigenesis, and wound healing. In addition to increasing proliferation, CXCL1 also induces cancer cell migration, particularly EMT.Produced by lymphatic endothelial cells (LECs), CXCL1 enables tumor cell migration into the lymphatic vessels during lymphangiogenesis, leading to lymph node metastasis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 30678838631

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 10 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
I
Verified Purchase
idk
Louisville, US
★★★★★ 5
All star
Size: Large, Color: Black, Size: Large, Color: Black
Somehow my puppers knew this was for him immediately...I hadn't even inflated it with the included ball pump yet! He sat patiently waiting and then just lost it when it was ready for play. He uses the tabs to grab it but also can grab the side of the ball and hasn't punctured it yet. He loves when we do foot work trying to get it. He posed just like the Pros for a picture afterward. Paws down Teddy's new favorite toy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 11, 2026
J
Verified Purchase
John Beamon
Carnegie, US
★★★★★ 1
This ball used to be better made
Size: Large, Color: Black, Size: Large, Color: Black
This is my 3rd ball in the last several years. I purchased this one on 3/17/26. My dog and I play soccer every evening for 15 minutes, and I never leave her alone with the ball. The main handle has torn away from the ball, as you can see in the picture. I am disappointed and will hopefully find a better replacement.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 11, 2026
D
Verified Purchase
Diamondgbf
Charlottesville, US
★★★★★ 5
So fun!! my dog loves this!!
Size: Large, Color: Black
Oh my gosh, finally a toy that he loves so much that doesn’t squeak!!! I have a big German Shepherd/Doberman and he loves this toy. He grabs one of those loops and he shakes it back-and-forth and I Chase him around the house. I throw it for him. It’s just so fun. When I have it and I wanna try to roll it past him really fast. He just puts his paw out like he’s a professional soccer player! I will definitely buy this again when all the little loops get chewed off but so far he’s only been able to chew off the main loop.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 27, 2026
M
Verified Purchase
MR Mike
Fort Morgan, US
★★★★★ 5
Mackie gives these balls 5 stars
Size: Medium, Color: Black, Size: Medium, Color: Black
Best Jack Russell soccer ball ever. At 4 years Mackie has only punctuated 1 out of 5. Even Super Hero’s love a great soccer ball. Excellent gifts for your furry friends coast to coast. Highly Recommend
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 12, 2026
R
Verified Purchase
Rebecca
Waukegan, US
★★★★★ 5
Good for a dog who likes to chew
Size: Small, Color: Black
I bought this for our 7mo puppy. She loves to fetch the ball and chew on the tabs. The tabs are sturdy if you have a dog who loves to chew. Perfect size for our girl. It is a great for when she has pent up energy. It's below zero where we are so finding an indoor game is essential.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 27, 2026

recommand products